FAM71E2 Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 20904-1-AP (same clone as 20904-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 20904-1-AP (FAM71E2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20904-1-AP (same clone as 20904-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20904-1-AP (FAM71E2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20904-1-AP (same clone as 20904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20904-1-AP (FAM71E2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20904-1-AP (same clone as 20904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20904-1-AP (FAM71E2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20904-1-AP (same clone as 20904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20904-1-AP (FAM71E2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20904-1-AP (same clone as 20904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 20904-1-AP (FAM71E2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20904-1-PBS in a different storage buffer formulation.

FAM71E2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

20904-1-PBS targets FAM71E2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15027

  Product name: Recombinant human FAM71E2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 74-197 aa of BC031875

  Sequence: SLPGLVLPDILLIGQPAEDRDCSGLVLTRMIPLDLVHLCVHDLSAWRLKLRLVSGRQYYLALDAPDNEVGFLFHCWVRLINLLQEPAPTWTPRTTRTAPLDMPLAKAPASTWHLQDQPISRHAV

• Full Name: family with sequence similarity 71, member E2
• Calculated Molecular Weight: 302 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC031875
• Gene Symbol: FAM71E2
• Gene ID (NCBI): 284418
• RRID: AB_11183765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5Q1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.