FARP1 Recombinant monoclonal antibody, PBS Only (Detector)

FARP1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 85638-2-PBS
Clone No.243132B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CDEP, Chondrocyte-derived ezrin-like protein, FERM, ARHGEF and pleckstrin domain-containing protein 1, FERM, RhoGEF and pleckstrin domain-containing protein 1, PH domain-containing family C member 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85638-2-PBS targets FARP1 as part of a matched antibody pair:

MP02060-1: 85638-3-PBS capture and 85638-2-PBS detection (validated in Cytometric bead array)

MP02060-2: 85638-1-PBS capture and 85638-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21225

Product name: Recombinant human FARP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 347-539 aa of BC071592

Sequence: VLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTD

Predict reactive species
Full Name FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
Calculated Molecular Weight 1076 aa, 122 kDa
GenBank Accession NumberBC071592
Gene Symbol FARP1
Gene ID (NCBI) 10160
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y4F1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...