SLC27A4/FATP4 Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 11013-1-AP (same clone as 11013-1-PBS)

  WB result of FATP4 antibody (11013-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-FATP4 transfected HepG2 cells. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 11013-1-AP (same clone as 11013-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11013-1-AP (same clone as 11013-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11013-1-AP (same clone as 11013-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11013-1-AP (same clone as 11013-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 11013-1-AP (same clone as 11013-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 11013-1-AP (same clone as 11013-1-PBS)

  IP result of anti-FATP4 (IP:11013-1-AP, 4ug; Detection:11013-1-AP 1:500) with HepG2 cells lysate 1600ug. This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11013-1-AP (same clone as 11013-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11013-1-AP (FATP4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11013-1-AP (same clone as 11013-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11013-1-AP (FATP4 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11013-1-AP (same clone as 11013-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11013-1-AP (FATP4 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11013-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC27A4/FATP4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11013-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

FATP 4, SLC27A4, ACSVL4, Arachidonate--CoA ligase, EC:6.2.1.-

---

Product Information

11013-1-PBS targets SLC27A4/FATP4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1490

  Product name: Recombinant human SLC27A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC009959

  Sequence: MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

• Full Name: solute carrier family 27 (fatty acid transporter), member 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC009959
• Gene Symbol: FATP4/SLC27A4
• Gene ID (NCBI): 10999
• RRID: AB_2190637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1M0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.