SLC27A4/FATP4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC27A4/FATP4 Polyclonal antibody (11013-1-AP)

• Featured Product
• KD/KO Validated

SLC27A4/FATP4 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11013-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

FATP 4, SLC27A4, ACSVL4, Arachidonate--CoA ligase, EC:6.2.1.-

• 

  WB analysis of HepG2 using 11013-1-AP

  WB result of FATP4 antibody (11013-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-FATP4 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11013-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11013-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SMMC-7721 using 11013-1-AP

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 11013-1-AP (FATP4 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 11013-1-AP

  IP result of anti-FATP4 (IP:11013-1-AP, 4ug; Detection:11013-1-AP 1:500) with HepG2 cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11013-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11013-1-AP (FATP4 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11013-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11013-1-AP (FATP4 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 11013-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11013-1-AP (FATP4 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC27A4/FATP4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse liver tissue, SMMC-7721 cells, mouse colon tissue, rat colon tissue, rat liver tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11013-1-AP targets SLC27A4/FATP4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1490

  Product name: Recombinant human SLC27A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC009959

  Sequence: MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

• Full Name: solute carrier family 27 (fatty acid transporter), member 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC009959
• Gene Symbol: FATP4/SLC27A4
• Gene ID (NCBI): 10999
• RRID: AB_2190637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P1M0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC27A4/FATP4 Polyclonal antibody (Cat# 11013-1-AP) has 24 citations. These appear in journals including Cell Metabolism, Immunity, Nature Communications, Experimental Hematology & Oncology, Cell Death & Disease, Phytomedicine, Frontiers in Immunology, Journal of Agricultural and Food Chemistry, Biochemical Pharmacology, Cells, International Journal of Molecular Sciences, Journal of Nutritional Biochemistry, Scientific Reports, iScience, Journal of Nutrition, Animals, Genes, PLoS One, Molecular Reproduction and Development, Biochemical and Biophysical Research Communications, and Biochimica et Biophysica Acta. Research fields span lipid metabolism, fatty acid transport, obesity, NAFLD, intestinal barrier function, gut microbiota, placental nutrient transport, and cancer.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IF	Cell Metab; Liver-breast communication of adipocyte-oriented exosomes drives primary mammary cancer progression; Authors - Chunni Li
		Immunity; Gasdermin-D-mediated epithelial-immune circuit synchronizes nutrient absorption and host defense in the small intestine; Authors - Qianzhou Yu
mouse	WB	Nat Commun; Galactooligosaccharides and Limosilactobacillus reuteri synergistically alleviate gut inflammation and barrier dysfunction by enriching Bacteroides acidifaciens for pentadecanoic acid biosynthesis; Authors - Yujun Wu
human	WB,IHC	Exp Hematol Oncol; NAT10-mediated lipid metabolic reprogramming drives EGFR-TKI resistance in non-small cell lung cancer via ac4C-dependent mRNA stabilization.; Authors - Shuai Fang ; KD Validated
mouse,human	WB	Cell Death Dis; B-cell lymphoma 6 alleviates nonalcoholic fatty liver disease in mice through suppression of fatty acid transporter CD36.; Authors - Hao Zhang
		Phytomedicine; Jiawei Shoutai Pill promotes embryo implantation via PPAR signaling and endometrial microbiota remodeling: An integrative multi-omics study.; Authors - Yi Zhang