Tested Applications
| Positive WB detected in | mouse brain tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue,  mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:150-1:600 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
27056-1-AP targets FBP17 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag25784 Product name: Recombinant human FNBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 176-241 aa of BC101755 Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV Predict reactive species | 
                                    
| Full Name | formin binding protein 1 | 
| Observed Molecular Weight | 80-85 kDa | 
| GenBank Accession Number | BC101755 | 
| Gene Symbol | FBP17 | 
| Gene ID (NCBI) | 23048 | 
| RRID | AB_2880734 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96RU3 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBP17 antibody 27056-1-AP | Download protocol | 
| IP protocol for FBP17 antibody 27056-1-AP | Download protocol | 
| WB protocol for FBP17 antibody 27056-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Cicek (Verified Customer) (06-11-2024)  | I tested the antibody on mouse neurons, iPSCs and 3-weeks-old iNeurons with Western blotting using beta-actin as positive control. There were bands at the 80 kDa mark showing FBP17 for iPSC and iNeurons, but not mouse neurons. All samples showed a strong unspecific band at 70 kDa mark. 
  | 
FH María (Verified Customer) (02-08-2022)  | Works fine for WB (1:1000), for IF some background, even after several washes with detergent 
  | 



















