Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
23624-1-AP targets FBXL19 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20198 Product name: Recombinant human FBXL19 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 444-524 aa of BC059173 Sequence: SVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS Predict reactive species |
| Full Name | F-box and leucine-rich repeat protein 19 |
| Calculated Molecular Weight | 694 aa, 76 kDa |
| Observed Molecular Weight | 60-75 kDa |
| GenBank Accession Number | BC059173 |
| Gene Symbol | FBXL19 |
| Gene ID (NCBI) | 54620 |
| RRID | AB_3085713 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q6PCT2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FBXL19 antibody 23624-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

