FBXL6 Polyclonal antibody

• 

  WB analysis using 33265-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33265-1-AP (FBXL6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FBXL6 Polyclonal Antibody for WB, ELISA

Cat No. 33265-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FBL6, FBL6A, F-box and leucine-rich repeat protein 6, F-box protein FBL6, F-box/LRR-repeat protein 6

---

Tested Applications

• Positive WB detected in: 786-O cells, ACHN cells, HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33265-1-AP targets FBXL6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36604

  Product name: Recombinant human FBXL6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-182 aa of NM_012162.3

  Sequence: MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQPPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLL

• Full Name: F-box and leucine-rich repeat protein 6
• Calculated Molecular Weight: 59kDa，539aa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_012162.3
• Gene Symbol: FBXL6
• Gene ID (NCBI): 26233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N531
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXL6 is an F-box/LRR-type E3 ubiquitin ligase that serves as the substrate-recognition subunit of the SCF complex. It stabilizes HSP90AA1 via K63-linked ubiquitination to activate c-MYC and drive hepatocellular carcinoma progression, while also degrading defective mitochondrial ribosomal proteins to preserve mitochondrial proteostasis. Its overexpression correlates with poor prognosis in renal and colorectal cancers and can promote cell proliferation by down-regulating RPL11 to activate the MDM2-p53 axis.