Tested Applications
| Positive WB detected in | LNCaP cells, U2OS cells |
| Positive IP detected in | LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
27610-1-AP targets FBXO11 in WB, IP, CoIP, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species |
| Full Name | F-box protein 11 |
| Calculated Molecular Weight | 927 aa, 104 kDa |
| Observed Molecular Weight | 94-104 kDa |
| GenBank Accession Number | BC012728 |
| Gene Symbol | FBXO11 |
| Gene ID (NCBI) | 80204 |
| RRID | AB_2880925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86XK2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FBXO11 antibody 27610-1-AP | Download protocol |
| IP protocol for FBXO11 antibody 27610-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
FEBS Open Bio The F-box protein FBXO11 restrains hepatocellular carcinoma stemness via promotion of ubiquitin-mediated degradation of Snail.
| ||
Clin Transl Med Cullin-associated and neddylation-dissociated 1 regulate reprogramming of lipid metabolism through SKP1-Cullin-1-F-boxFBXO11 -mediated heterogeneous nuclear ribonucleoprotein A2/B1 ubiquitination and promote hepatocellular carcinoma
|



