Tested Applications
Positive WB detected in | LNCaP cells, U2OS cells |
Positive IP detected in | LNCaP cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 2 publications below |
CoIP | See 1 publications below |
Product Information
27610-1-AP targets FBXO11 in WB, IP, CoIP, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species |
Full Name | F-box protein 11 |
Calculated Molecular Weight | 927 aa, 104 kDa |
Observed Molecular Weight | 94-104 kDa |
GenBank Accession Number | BC012728 |
Gene Symbol | FBXO11 |
Gene ID (NCBI) | 80204 |
RRID | AB_2880925 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86XK2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FBXO11 antibody 27610-1-AP | Download protocol |
IP protocol for FBXO11 antibody 27610-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
FEBS Open Bio The F-box protein FBXO11 restrains hepatocellular carcinoma stemness via promotion of ubiquitin-mediated degradation of Snail.
| ||
Clin Transl Med Cullin-associated and neddylation-dissociated 1 regulate reprogramming of lipid metabolism through SKP1-Cullin-1-F-boxFBXO11 -mediated heterogeneous nuclear ribonucleoprotein A2/B1 ubiquitination and promote hepatocellular carcinoma
|