FBXO11 Polyclonal antibody

• 

  WB analysis using 27610-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27610-1-AP (FBXO11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of LNCaP using 27610-1-AP

  IP result of anti-FBXO11 (IP:27610-1-AP, 4ug; Detection:27610-1-AP 1:500) with LNCaP cells lysate 2400 ug.

• Featured Product
• KD/KO Validated

FBXO11 Polyclonal Antibody for WB, IP, ELISA

Cat No. 27610-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IP, CoIP, ELISA

Synonyms

F box only protein 11, F box protein 11, FBX11, FBXO11, PRMT9, UBR6, UG063H01, VIT 1, VIT1, Vitiligo associated protein 1

---

Tested Applications

• Positive WB detected in: LNCaP cells, U2OS cells
• Positive IP detected in: LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• CoIP: See 1 publications below

Product Information

27610-1-AP targets FBXO11 in WB, IP, CoIP, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24401

  Product name: Recombinant human FBXO11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 858-927 aa of BC012728

  Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN

• Full Name: F-box protein 11
• Calculated Molecular Weight: 927 aa, 104 kDa
• Observed Molecular Weight: 94-104 kDa
• GenBank Accession Number: BC012728
• Gene Symbol: FBXO11
• Gene ID (NCBI): 80204
• RRID: AB_2880925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XK2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FEBS Open Bio; The F-box protein FBXO11 restrains hepatocellular carcinoma stemness via promotion of ubiquitin-mediated degradation of Snail.; Authors - Lijiang Shao ; KD Validated
human	WB,CoIP	Clin Transl Med; Cullin-associated and neddylation-dissociated 1 regulate reprogramming of lipid metabolism through SKP1-Cullin-1-F-boxFBXO11 -mediated heterogeneous nuclear ribonucleoprotein A2/B1 ubiquitination and promote hepatocellular carcinoma; Authors - Hao Zhang ; KD Validated