FBXO21 Polyclonal antibody

FBXO21 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 17648-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, IP, ELISA

F box only protein 21, F box protein 21, F-box only protein 21, FBX21, FBXO 21

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue
Positive IP detected inA549 cells, rat brain tissue
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17648-1-AP targets FBXO21 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11882

Product name: Recombinant human FBXO21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 187-537 aa of BC034045

Sequence: DQLKFKGNRMDYYNALNLYMHQVLIRRTGIPISMSLLYLTIARQLGVPLEPVNFPSHFLLRWCQGAEGATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALYGVVNVKKVLQRMVGNLLSLGKREGIDQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE

Predict reactive species
Full Name F-box protein 21
Calculated Molecular Weight 537 aa, 63 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC034045
Gene Symbol FBXO21
Gene ID (NCBI) 23014
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94952
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO21 (F-box protein 21) is a member of the F-box protein family and serves as the substrate recognition component of the SCF (Skp1-Cullin-F-box) E3 ubiquitin ligase complex. In AML cells, FBXO21 can ubiquitinate p85α, a regulatory subunit of the PI3K pathway, leading to its degradation. This reduces PI3K signaling, promotes p85α dimerization, and activates ERK, thereby influencing cell proliferation and survival. Silencing FBXO21 in AML cells induces differentiation, inhibits tumor progression, and increases sensitivity to chemotherapeutic agents. FBXO21 can regulate immune responses by ubiquitinating and degrading proteins like ASK1 through pro-inflammatory cytokine pathways. It can also ubiquitinate p85α, affecting CXCL10 expression and modulating immune cell infiltration and anti-tumor activity. In renal cell carcinoma, overexpression of FBXO21 significantly suppresses ccRCC cell proliferation and metastasis both in vitro and in vivo. It may be related to the stromal score and the infiltration levels of immune cells associated with prognosis. Additionally, FBXO21 overexpression increases the expression of key molecules in the CREB pathway.

Protocols

Product Specific Protocols
IF protocol for FBXO21 antibody 17648-1-APDownload protocol
IP protocol for FBXO21 antibody 17648-1-APDownload protocol
WB protocol for FBXO21 antibody 17648-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...