FBXO31 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 27294-1-AP (same clone as 27294-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27294-1-AP (FBXO31 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse uterus using 27294-1-AP (same clone as 27294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse uterus tissue slide using 27294-1-AP (FBXO31 antibody) at dilution of 1:1200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27294-1-PBS in a different storage buffer formulation.

FBXO31 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27294-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

F box only protein 31, F box protein 31, F-box only protein 31, FBX14, FBX31

---

Product Information

27294-1-PBS targets FBXO31 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24867

  Product name: Recombinant human FBXO31 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-178 aa of BC012748

  Sequence: MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH

• Full Name: F-box protein 31
• Observed Molecular Weight: 49 kDa, 60-70 kDa
• GenBank Accession Number: BC012748
• Gene Symbol: FBXO31
• Gene ID (NCBI): 79791
• RRID: AB_2880833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5XUX0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FBXO31, also known as F-box protein 31, is a substrate recognition protein of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a crucial role in mediating the ubiquitination and subsequent degradation of target proteins through the ubiquitin-proteasome system. In pancreatic cancer, FBXO31 is upregulated and promotes cancer progression by targeting proteins like SIRT2 for degradation (PMID: 38216561). In endometrial cancer, FBXO31 acts as a tumor suppressor by regulating the ubiquitination of OGT (O-GlcNAc transferase), which affects cellular O-GlcNAcylation levels (PMID: 39894887). FBXO31 Is a reader of C-terminal amides, which ubiquitylates CTAPs for subsequent proteasomal degradation. A dominant de novo D334N mutation in FBXO31 alters FBXO31 substrate recognition and CTAP clearance, causing some important proteins to be degraded and clinical intellectual impairment or diplegic spastic cerebral (PMID: 39880951).