FBXO31 Polyclonal antibody

• 

  WB analysis of mouse brain using 27294-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27294-1-AP (FBXO31 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse uterus using 27294-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse uterus tissue slide using 27294-1-AP (FBXO31 antibody) at dilution of 1:1200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FBXO31 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27294-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

F box only protein 31, F box protein 31, F-box only protein 31, FBX14, FBX31

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: mouse uterus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:600-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

27294-1-AP targets FBXO31 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24867

  Product name: Recombinant human FBXO31 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-178 aa of BC012748

  Sequence: MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH

• Full Name: F-box protein 31
• Observed Molecular Weight: 49 kDa, 60-70 kDa
• GenBank Accession Number: BC012748
• Gene Symbol: FBXO31
• Gene ID (NCBI): 79791
• RRID: AB_2880833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5XUX0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FBXO31, also known as F-box protein 31, is a substrate recognition protein of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a crucial role in mediating the ubiquitination and subsequent degradation of target proteins through the ubiquitin-proteasome system. In pancreatic cancer, FBXO31 is upregulated and promotes cancer progression by targeting proteins like SIRT2 for degradation (PMID: 38216561). In endometrial cancer, FBXO31 acts as a tumor suppressor by regulating the ubiquitination of OGT (O-GlcNAc transferase), which affects cellular O-GlcNAcylation levels (PMID: 39894887). FBXO31 Is a reader of C-terminal amides, which ubiquitylates CTAPs for subsequent proteasomal degradation. A dominant de novo D334N mutation in FBXO31 alters FBXO31 substrate recognition and CTAP clearance, causing some important proteins to be degraded and clinical intellectual impairment or diplegic spastic cerebral (PMID: 39880951).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; F-box protein FBXO32 ubiquitinates and stabilizes D-type cyclins to drive cancer progression; Authors - Feng Li
human	WB	BMC Bioinformatics; LincRNA ZNF529-AS1 inhibits hepatocellular carcinoma via FBXO31 and predicts the prognosis of hepatocellular carcinoma patients; Authors - Yang Ma