Tested Applications
Positive WB detected in | human placenta tissue, Raji cells |
Positive IHC detected in | human tonsillitis tissue, human placenta tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21541-1-AP targets FCGR2B / CD32b in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16189 Product name: Recombinant human FCGR2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 254-310 aa of BC031992 Sequence: ALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Predict reactive species |
Full Name | Fc fragment of IgG, low affinity IIb, receptor (CD32) |
Calculated Molecular Weight | 310 aa, 34 kDa |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC031992 |
Gene Symbol | CD32b |
Gene ID (NCBI) | 2213 |
RRID | AB_2878881 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31994 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FCGR2B / CD32b antibody 21541-1-AP | Download protocol |
IHC protocol for FCGR2B / CD32b antibody 21541-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |