FCRL4 Recombinant monoclonal antibody

• 

  WB analysis using 86941-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86941-1-RR (FCRL4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86941-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86941-1-RR against Human FCRL4 were performed. The affinity constant is 13.8 nM.

FCRL4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86941-1-RR

Clone No.251351E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CD307d, Fc receptor homolog 4, Fc receptor-like protein 4, FcRH4, FcR-like protein 4

---

Tested Applications

• Positive WB detected in: Raji cells, K-562 cells, HL-60 cells, mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86941-1-RR targets FCRL4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4749

  Product name: recombinant human FCRL4 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 190-384 aa of NM_031282.2

  Sequence: FPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNR

• Full Name: Fc receptor-like 4
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_031282.2
• Gene Symbol: FCRL4
• Gene ID (NCBI): 83417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PJ5-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fc receptor-like (FCRL) 4 is an immunoregulatory receptor expressed on a subpopulation of human memory B cells of mucosa-associated lymphoid tissue. Fc receptor function of FCRL4 was demonstrated by binding of IgA to FCRL4 following heat aggregation of the Ig (PMID: 32513851).