FCRL4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86941-1-RR (same clone as 86941-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86941-1-RR (FCRL4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86941-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86941-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86941-1-RR against Human FCRL4 were performed. The affinity constant is 13.8 nM.

FCRL4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86941-1-PBS

Clone No.251351E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CD307d, Fc receptor homolog 4, Fc receptor-like protein 4, FcRH4, FcR-like protein 4

---

Product Information

86941-1-PBS targets FCRL4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4749

  Product name: recombinant human FCRL4 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 190-384 aa of NM_031282.2

  Sequence: FPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNR

• Full Name: Fc receptor-like 4
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_031282.2
• Gene Symbol: FCRL4
• Gene ID (NCBI): 83417
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PJ5-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fc receptor-like (FCRL) 4 is an immunoregulatory receptor expressed on a subpopulation of human memory B cells of mucosa-associated lymphoid tissue. Fc receptor function of FCRL4 was demonstrated by binding of IgA to FCRL4 following heat aggregation of the Ig (PMID: 32513851).