FDX1 Polyclonal antibody

• 

  WB analysis using 34182-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34182-1-AP (FDX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 34182-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34182-1-AP (FDX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

FDX1 Polyclonal Antibody for WB, ELISA

Cat No. 34182-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Adrenal ferredoxin, Adrenodoxin, mitochondrial, ADX, FDX, Ferredoxin-1

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat testis tissue, mouse testis tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34182-1-AP targets FDX1 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41687

  Product name: Recombinant mouse FDX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 64-184 aa of BC017063

  Sequence: DKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

• Full Name: ferredoxin 1
• Calculated Molecular Weight: 184 aa, 19 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC017063
• Gene Symbol: FDX1
• Gene ID (NCBI): 14148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P46656
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ferredoxin 1 (FDX1) is a small mitochondrial protein and recent studies have shown that FDX1 plays an important role in tumor cuproptosis. FDX1 expression is significantly downregulated in HCC tissues. FDX1 downregulation promotes HCC cell proliferation, invasion in vitro and growth, metastasis in vivo. In addition, FDX1 affects metabolism of HCC cells and is associated with autophagy (PMID: 39128228). FDX1 is localized to the mitochondria and contains a 64-amino-acid mitochondrial transit peptide that is cleaved during post-translational processing.