Tested Applications
| Positive WB detected in | mouse kidney tissue, COLO 320 cells, HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue, human pancreas tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 7 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
22215-1-AP targets Kindlin 1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17543 Product name: Recombinant human Kindlin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 321-420 aa of BC035882 Sequence: HISKLSLSAETQDFAGESEVDEIEAALSNLEVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL Predict reactive species |
| Full Name | fermitin family homolog 1 (Drosophila) |
| Calculated Molecular Weight | 677 aa, 77 kDa |
| Observed Molecular Weight | 70-77 kDa |
| GenBank Accession Number | BC035882 |
| Gene Symbol | Kindlin 1 |
| Gene ID (NCBI) | 55612 |
| RRID | AB_2879033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BQL6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Kindlin-1 is a FERM domain containing adaptor protein that is found predominantly at cell-extracellular matrix adhesions where it binds to β-integrin subunits and is required for integrin activation. Loss of function mutations in the FERMT1 gene which encodes Kindlin-1 leads to the development of Kindler Syndrome (KS) an autosomal recessive skin disorder characterized by skin blistering, photosensitivity, and predisposition to aggressive squamous cell carcinoma (SCC).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Kindlin 1 antibody 22215-1-AP | Download protocol |
| IHC protocol for Kindlin 1 antibody 22215-1-AP | Download protocol |
| WB protocol for Kindlin 1 antibody 22215-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Kindlin Regulates Mechanosensitive Activation and Adhesion Assembly of Integrin beta6 | ||
Cancer Cell Int FERMT1 contributes to the migration and invasion of nasopharyngeal carcinoma through epithelial-mesenchymal transition and cell cycle arrest.
| ||
Eur J Neurosci Wnt10a/β-catenin signaling is involved in kindlin-1-mediated astrocyte activation in a chronic construction injury rat model. | ||
Int J Mol Med Kindlin-1 contributes to EGF-induced re-epithelialization in skin wound healing. | ||
Cell Rep Distinct bidirectional regulation of LFA1 and α4β7 by Rap1 and integrin adaptors in T cells under shear flow | ||
J Cancer Res Clin Oncol FERMT1 suppression induces anti-tumor effects and reduces stemness in glioma cancer cells
|

























