Product Information
66811-1-PBS targets FFAR3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28025 Product name: Recombinant human FFAR3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 246-346 aa of BC035657 Sequence: VVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES Predict reactive species |
Full Name | free fatty acid receptor 3 |
Calculated Molecular Weight | 39 kDa |
Observed Molecular Weight | 40-48 kDa |
GenBank Accession Number | BC035657 |
Gene Symbol | FFAR3 |
Gene ID (NCBI) | 2865 |
RRID | AB_2882154 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O14843 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
FFAR3 (Free fatty acid receptors 3) also known as GPR41, with another GPR43 protein, both are Gai-coupled receptor activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate (PMID:26870043). GPR41 protein is translated from the bicistronic mRNA encoding GPR40 and GPR41, where an internal ribosome entry site (IRES) is utilized for the GPR41 coding sequence downstream of GPR40 (PMID:22493486). GPR41 is expressed in adipose tissue, gut, and the peripheral nervous system, and it is involved in SCFA-dependent energy regulation(PMID: 24904531).