FFAR3 Monoclonal antibody, PBS Only

• 

  WB analysis using 66811-1-Ig (same clone as 66811-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66811-1-Ig (FFAR3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66811-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human adipose using 66811-1-Ig (same clone as 66811-1-PBS)

  human adipose tissue were subjected to SDS PAGE followed by western blot with 66811-1-Ig (FFAR3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66811-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66811-1-Ig (same clone as 66811-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66811-1-Ig (FFAR3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66811-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66811-1-Ig (same clone as 66811-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66811-1-Ig (FFAR3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66811-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 66811-1-Ig (same clone as 66811-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 66811-1-Ig (FFAR3 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66811-1-PBS in a different storage buffer formulation.

FFAR3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66811-1-PBS

Clone No.1D10B7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GPR41, 1D10B7, FFA3R, free fatty acid receptor 3, G protein coupled receptor 41

---

Product Information

66811-1-PBS targets FFAR3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28025

  Product name: Recombinant human FFAR3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 246-346 aa of BC035657

  Sequence: VVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

• Full Name: free fatty acid receptor 3
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40-48 kDa
• GenBank Accession Number: BC035657
• Gene Symbol: FFAR3
• Gene ID (NCBI): 2865
• RRID: AB_2882154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14843
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FFAR3 (Free fatty acid receptors 3) also known as GPR41, with another GPR43 protein, both are Gai-coupled receptor activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate (PMID:26870043). GPR41 protein is translated from the bicistronic mRNA encoding GPR40 and GPR41, where an internal ribosome entry site (IRES) is utilized for the GPR41 coding sequence downstream of GPR40 (PMID:22493486). GPR41 is expressed in adipose tissue, gut, and the peripheral nervous system, and it is involved in SCFA-dependent energy regulation(PMID: 24904531).