Tested Applications
Positive WB detected in | mouse heart tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
26235-1-AP targets FGF13 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23965 Product name: Recombinant human FGF13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 212-245 aa of BC034340 Sequence: LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST Predict reactive species |
Full Name | fibroblast growth factor 13 |
Calculated Molecular Weight | 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC034340 |
Gene Symbol | FGF13 |
Gene ID (NCBI) | 2258 |
RRID | AB_2880438 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92913 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FGF13 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FGF13 antibody 26235-1-AP | Download protocol |
IHC protocol for FGF13 antibody 26235-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |