Tested Applications
Positive WB detected in | MCF-7 cells, PC-3 cells |
Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
25314-1-AP targets FGF17 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17807 Product name: Recombinant human FGF17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-216 aa of BC105131 Sequence: AFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT Predict reactive species |
Full Name | fibroblast growth factor 17 |
Calculated Molecular Weight | 216 aa, 25 kDa |
Observed Molecular Weight | 33 kDa |
GenBank Accession Number | BC105131 |
Gene Symbol | FGF17 |
Gene ID (NCBI) | 8822 |
RRID | AB_2880025 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60258 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FGF17 antibody 25314-1-AP | Download protocol |
IF protocol for FGF17 antibody 25314-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |