FGF17 Polyclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 25314-1-AP (same clone as 25314-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25314-1-AP (FGF17 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25314-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 25314-1-AP (same clone as 25314-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25314-1-AP (FGF17 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25314-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 25314-1-AP (same clone as 25314-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using FGF17 antibody (25314-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 25314-1-PBS in a different storage buffer formulation.

FGF17 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25314-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FGF 17, FGF-17, Fibroblast growth factor 17, UNQ161/PRO187

---

Product Information

25314-1-PBS targets FGF17 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17807

  Product name: Recombinant human FGF17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-216 aa of BC105131

  Sequence: AFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

• Full Name: fibroblast growth factor 17
• Calculated Molecular Weight: 216 aa, 25 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC105131
• Gene Symbol: FGF17
• Gene ID (NCBI): 8822
• RRID: AB_2880025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60258
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.