Product Information
25314-1-PBS targets FGF17 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17807 Product name: Recombinant human FGF17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 140-216 aa of BC105131 Sequence: AFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT Predict reactive species |
Full Name | fibroblast growth factor 17 |
Calculated Molecular Weight | 216 aa, 25 kDa |
Observed Molecular Weight | 33 kDa |
GenBank Accession Number | BC105131 |
Gene Symbol | FGF17 |
Gene ID (NCBI) | 8822 |
RRID | AB_2880025 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60258 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |