Product Information
83033-1-PBS targets FGF-21 as part of a matched antibody pair:
MP00005-1: 83033-1-PBS capture and 83033-2-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Affinity | KD=3.67 x 10-10M KOff=3.38 x 10-4M KOn=9.20 x 105M |
| Immunogen |
CatNo: Eg0102 Product name: Recombinant Human FGF-21 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: N-6*His Domain: 29-209 aa of BC018404 Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Predict reactive species |
| Full Name | fibroblast growth factor 21 |
| Calculated Molecular Weight | 22 kDa |
| GenBank Accession Number | BC018404 |
| Gene Symbol | FGF21 |
| Gene ID (NCBI) | 26291 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NSA1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



