CoraLite® Plus 647-conjugated FGFR1OP Polyclonal antibody

• 

  IF Staining of C2C12 using CL647-11343

  Immunofluorescent analysis of (-20°C Methanol) fixed C2C12 cells using CoraLite® Plus 647 FGFR1OP antibody (CL647-11343) at dilution of 1:400.

• Featured Product
• KD/KO Validated

FGFR1OP Polyclonal Antibody for IF/ICC

Cat No. CL647-11343

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

FGFR1 oncogene partner, FGFR1OP, FOP

---

Tested Applications

• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11343 targets FGFR1OP in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1891

  Product name: Recombinant human FGFR1OP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-374 aa of BC011902

  Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADY

• Full Name: FGFR1 oncogene partner
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011902
• Gene Symbol: FGFR1OP
• Gene ID (NCBI): 11116
• RRID: AB_2920217
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95684
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The fibroblast growth factor receptor 1 oncogene partner (FGFR1OP), FOP, is a centrosomal protein that is involved in the anchoring of microtubules to subcellular structures. Three isoforms have been produced by alternative splicing. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). MPD is characterized by myeloid hyperplasia, eosinophilia and T-cell or B-cell lymphoblastic lymphoma and progresses to acute myeloid leukemia.