FGFR1OP2 Polyclonal antibody, PBS Only

• 

  WB analysis using 11605-1-AP (same clone as 11605-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11605-1-AP (FGFR1OP2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11605-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11605-1-AP (same clone as 11605-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11605-1-AP (FGFR1OP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11605-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11605-1-AP (same clone as 11605-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11605-1-AP (FGFR1OP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11605-1-PBS in a different storage buffer formulation.

FGFR1OP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11605-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HSPC123 like, HSPC123, FGFR1 oncogene partner 2

---

Product Information

11605-1-PBS targets FGFR1OP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2153

  Product name: Recombinant human FGFR1OP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC032143

  Sequence: MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDPGIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQNVH

• Full Name: FGFR1 oncogene partner 2
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC032143
• Gene Symbol: FGFR1OP2
• Gene ID (NCBI): 26127
• RRID: AB_10863652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVK5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.