FHIT Polyclonal antibody, PBS Only

• 

  WB analysis using 13362-1-AP (same clone as 13362-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13362-1-AP (FHIT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13362-1-PBS in a different storage buffer formulation.

FHIT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13362-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13362-1-PBS targets FHIT in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4181

  Product name: Recombinant human FHIT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC032336

  Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

• Full Name: fragile histidine triad gene
• Calculated Molecular Weight: 147 aa, 17 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC032336
• Gene Symbol: FHIT
• Gene ID (NCBI): 2272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49789
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The candidate tumor suppressor gene, FHIT(Fragile histidine triad protein), encompasses the common human chromosomal fragile site at 3p14.2, the hereditary renal cancer translocation breakpoint, and cancer cell homozygous deletions. Fhit hydrolyzes dinucleotide 5',5'''-P1,P3-triphosphate in vitro and mutation of a central histidine abolishes hydrolase activity(PMID:9391102). FHIT has a major role in regulating beta-catenin-mediated gene transcription.