Tested Applications
| Positive WB detected in | HeLa cells, U2OS cells, hTERT-RPE1 cells, NIH/3T3 cells | 
| Positive IP detected in | mouse skeletal muscle tissue | 
| Positive IHC detected in | human cervical cancer tissue, human skin cancer tissue,  mouse kidney tissue,  mouse ovary tissue,  rat heart tissue,  rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HeLa cells, A431 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 16 publications below | 
| IHC | See 5 publications below | 
| IF | See 4 publications below | 
| IP | See 2 publications below | 
| CoIP | See 4 publications below | 
Product Information
21619-1-AP targets FHL2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1378 Product name: Recombinant human FHL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC014397 Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI Predict reactive species | 
                                    
| Full Name | four and a half LIM domains 2 | 
| Calculated Molecular Weight | 32 kDa | 
| Observed Molecular Weight | 32 kDa | 
| GenBank Accession Number | BC014397 | 
| Gene Symbol | FHL2 | 
| Gene ID (NCBI) | 2274 | 
| RRID | AB_10860263 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q14192 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
FHL2(Four and a half LIM domains protein 2), also known as DRAL. It is located in cytoplasm and nucleus. The protein is expressed in skeletal muscle and heart. May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes (PMID: 28717008). The molecular weight of FHL2 is 32 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FHL2 antibody 21619-1-AP | Download protocol | 
| IHC protocol for FHL2 antibody 21619-1-AP | Download protocol | 
| IP protocol for FHL2 antibody 21619-1-AP | Download protocol | 
| WB protocol for FHL2 antibody 21619-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Commun A signature motif in LIM proteins mediates binding to checkpoint proteins and increases tumour radiosensitivity. | ||
EBioMedicine Up-regulated FHL2 inhibits ovulation through interacting with androgen receptor and ERK1/2 in polycystic ovary syndrome. | ||
Cell Death Dis FHL2 deficiency impairs follicular development and fertility by attenuating EGF/EGFR/YAP signaling in ovarian granulosa cells
  | ||
iScience Genetic ablation of diabetes-associated gene Ccdc92 reduces obesity and insulin resistance in mice | ||
Int J Mol Sci FHL2 Inhibits SARS-CoV-2 Replication by Enhancing IFN-β Expression through Regulating IRF-3
  | ||
J Virol Structural and Functional Characterization of Host FHL1 Protein Interaction with Hypervariable Domain of Chikungunya Virus nsP3 Protein. | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marina (Verified Customer) (03-24-2025)  | 80 micrograms of cell lysate (U-373 MG cells). Primary antibody dilution 1:1000, overnight incubation at 4 degrees. 
 ![]()  | 
































