Tested Applications
| Positive WB detected in | mouse cerebellum tissue, HeLa cells, MCF-7 cells | 
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
Product Information
11700-1-AP targets FKBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2255 Product name: Recombinant human FKBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC003384 Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL Predict reactive species | 
                                    
| Full Name | FK506 binding protein 2, 13kDa | 
| Calculated Molecular Weight | 142 aa, 16 kDa | 
| Observed Molecular Weight | 13-16 kDa | 
| GenBank Accession Number | BC003384 | 
| Gene Symbol | FKBP2 | 
| Gene ID (NCBI) | 2286 | 
| RRID | AB_2102876 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P26885 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant(PMID:8373365).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FKBP2 antibody 11700-1-AP | Download protocol | 
| WB protocol for FKBP2 antibody 11700-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Cell Physiol Multiple roles for peptidylglycine α-amidating monooxygenase in the response to hypoxia. | ||
Endocrinology Changes in Corticotrope Gene Expression Upon Increased Expression of Peptidylglycine α-Amidating Monooxygenase. | 









