FKBP2 Recombinant monoclonal antibody

FKBP2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84077-6-RR
Clone No.241166B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

FKBP 2, FKBP 13, FK506-binding protein 2, EC:5.2.1.8, 241166B9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, K-562 cells, HuH-7 cells, NIH/3T3 cells, mouse cerebellum tissue, rat brain tissue
Positive IHC detected inhuman placenta tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84077-6-RR targets FKBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2255

Product name: Recombinant human FKBP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC003384

Sequence: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

Predict reactive species
Full Name FK506 binding protein 2, 13kDa
Calculated Molecular Weight 142 aa, 16 kDa
Observed Molecular Weight 13-16 kDa
GenBank Accession NumberBC003384
Gene Symbol FKBP2
Gene ID (NCBI) 2286
RRIDAB_3671646
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP26885
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP2 is also named as FKBP13 and belongs to the FKBP-type PPIase family. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP2 has a 21-amino acid signal peptide and appears to be membrane-associated(PMID:1713687). It is localized to the lumen of the endoplasmic reticulum (ER). FKBP12 and FKBP13 are highly similar proteins, of molecular masses 12 kDa and 13 kDa respectively, with approx.43 % amino acid identity. The strong homology between FKBP12 and FKBP13 suggests that they may share similar biological functions, although, apart from rotamase activity, details relating to the function of either protein are scant (PMID:8373365).

Protocols

Product Specific Protocols
IHC protocol for FKBP2 antibody 84077-6-RRDownload protocol
WB protocol for FKBP2 antibody 84077-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...