FLAD1 Monoclonal antibody

• 

  WB analysis using 68491-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68491-1-Ig (FLAD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 68491-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 68491-1-Ig (FLAD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 68491-1-Ig

  WB result of FLAD1 antibody (68491-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FLAD1 transfected HEK-293 cells.

• 

  IHC staining of mouse kidney using 68491-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 68491-1-Ig (FLAD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 68491-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 68491-1-Ig (FLAD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat stomach using 68491-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 68491-1-Ig (FLAD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FLAD1 Monoclonal Antibody for WB, ELISA

Cat No. 68491-1-Ig

Clone No.1F9A8

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, CoIP, ELISA

Synonyms

FAD1, FAD synthase region, FAD synthase, FAD pyrophosphorylase, EC:2.7.7.2

---

Tested Applications

• Positive WB detected in: LNCaP cells, HEK-293 cells, U2OS cells, HeLa cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• CoIP: See 1 publications below

Product Information

68491-1-Ig targets FLAD1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6845

  Product name: Recombinant human FLAD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 148-447 aa of BC011378

  Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG

• Full Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
• Calculated Molecular Weight: 446 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011378
• Gene Symbol: FLAD1
• Gene ID (NCBI): 80308
• RRID: AB_3085202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NFF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Nat Commun; FAD synthase confers ferroptosis resistance and restrains CD8+ T cell recruitment in hepatocellular carcinoma; Authors - Jiashuo Chao ; KD Validated