FLAD1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68491-1-Ig (same clone as 68491-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68491-1-Ig (FLAD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68491-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 68491-1-Ig (same clone as 68491-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 68491-1-Ig (FLAD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68491-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68491-1-Ig (same clone as 68491-1-PBS)

  WB result of FLAD1 antibody (68491-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FLAD1 transfected HEK-293 cells. This data was developed using the same antibody clone with 68491-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FLAD1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68491-1-PBS

Clone No.1F9A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FAD1, FAD synthase region, FAD synthase, FAD pyrophosphorylase, EC:2.7.7.2

---

Product Information

68491-1-PBS targets FLAD1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6845

  Product name: Recombinant human FLAD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 148-447 aa of BC011378

  Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG

• Full Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
• Calculated Molecular Weight: 446 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011378
• Gene Symbol: FLAD1
• Gene ID (NCBI): 80308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NFF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637).