Tested Applications
Positive WB detected in | mouse liver tissue, rat liver |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24928 Product name: Recombinant human FLVCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-526 aa of BC019087 Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL Predict reactive species |
Full Name | feline leukemia virus subgroup C cellular receptor family, member 2 |
Calculated Molecular Weight | 526 aa, 57 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC019087 |
Gene Symbol | FLVCR2 |
Gene ID (NCBI) | 55640 |
RRID | AB_2918106 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UPI3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FLVCR2 antibody 26704-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4 C; Incubation with secondary antibody (rabbit) 2h at RT.
![]() |