Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24928 Product name: Recombinant human FLVCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-526 aa of BC019087 Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL Predict reactive species |
| Full Name | feline leukemia virus subgroup C cellular receptor family, member 2 |
| Calculated Molecular Weight | 526 aa, 57 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC019087 |
| Gene Symbol | FLVCR2 |
| Gene ID (NCBI) | 55640 |
| RRID | AB_2918106 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FLVCR2 antibody 26704-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody (Cat# 26704-1-AP) has 3 total citations. They appear in Free Radical Biology and Medicine, Frontiers in Cell and Developmental Biology, and Clinical and Experimental Ophthalmology. The research fields span myocardial pyroptosis via a heme-mediated liver-heart axis, FLVCR2 as a prognostic marker in acute myeloid leukemia, and FLVCR1 deficiency in retinal degeneration involving mitochondrial homeostasis. Applications cited include Western blot in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Heme-mediated liver-heart axis promotes myocardial pyroptosis in db/db mice. | ||
Front Cell Dev Biol The prognostic marker FLVCR2 associated with tumor progression and immune infiltration for acute myeloid leukemia | ||
Clin Exp Ophthalmol FLVCR1 Deficiency Impairs Mitochondrial Homeostasis in Retinal Degeneration: Choline as a Potential Therapy. |
Reviews
What customers say
The single review for this product is a 5-star rating for Western Blot on human cell lines. The user reported successful results using a 1:500 dilution, with overnight primary antibody incubation at 4°C followed by a 2-hour secondary antibody (rabbit) incubation at room temperature. The protocol was straightforward and yielded clear results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4 C; Incubation with secondary antibody (rabbit) 2h at RT.
 |
