FLVCR2 Polyclonal antibody

• 

  WB analysis using 26704-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26704-1-AP (FLVCR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FLVCR2 Polyclonal Antibody for WB, ELISA

Cat No. 26704-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C14orf58, Calcium chelate transporter, CCT, FLVCR2, FLVCRL14q, MFSD7C

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24928

  Product name: Recombinant human FLVCR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 476-526 aa of BC019087

  Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL

• Full Name: feline leukemia virus subgroup C cellular receptor family, member 2
• Calculated Molecular Weight: 526 aa, 57 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC019087
• Gene Symbol: FLVCR2
• Gene ID (NCBI): 55640
• RRID: AB_2918106
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Cell Dev Biol; The prognostic marker FLVCR2 associated with tumor progression and immune infiltration for acute myeloid leukemia; Authors - Xiuhua Su

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Marina (Verified Customer) (07-24-2024)

Incubation with primary antibody ON at 4 C; Incubation with secondary antibody (rabbit) 2h at RT.

• Applications: Western Blot
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Human cell lines

FLVCR2 Antibody Western Blot validation (1:500 dilution) in Human cell lines (Cat no:26704-1-AP)