Filter:
Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24928 Product name: Recombinant human FLVCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-526 aa of BC019087 Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL Predict reactive species |
| Full Name | feline leukemia virus subgroup C cellular receptor family, member 2 |
| Calculated Molecular Weight | 526 aa, 57 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC019087 |
| Gene Symbol | FLVCR2 |
| Gene ID (NCBI) | 55640 |
| RRID | AB_2918106 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPI3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FLVCR2 antibody 26704-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Exp Ophthalmol FLVCR1 Deficiency Impairs Mitochondrial Homeostasis in Retinal Degeneration: Choline as a Potential Therapy. | ||
Front Cell Dev Biol The prognostic marker FLVCR2 associated with tumor progression and immune infiltration for acute myeloid leukemia |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4 C; Incubation with secondary antibody (rabbit) 2h at RT.
 |
