FMN2 Polyclonal antibody, PBS Only

• 

  IHC staining of human ovary tumor using 11259-1-AP (same clone as 11259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11259-1-AP (same clone as 11259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11259-1-AP (same clone as 11259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11259-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11259-1-AP (same clone as 11259-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11259-1-PBS in a different storage buffer formulation.

FMN2 Polyclonal Antibody for IHC, ELISA

Cat No. 11259-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

---

Product Information

11259-1-PBS targets FMN2 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1774

  Product name: Recombinant human FMN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1509-1722 aa of BC014364

  Sequence: GQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT

• Full Name: formin 2
• Calculated Molecular Weight: 195 kDa
• Observed Molecular Weight: 195 kDa
• GenBank Accession Number: BC014364
• Gene Symbol: FMN2
• Gene ID (NCBI): 56776
• RRID: AB_2105250
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.