FMN2 Polyclonal antibody

• 

  IHC staining of human ovary tumor using 11259-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 11259-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 11259-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 11259-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11259-1-AP (FMN2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

FMN2 Polyclonal Antibody for IHC, ELISA

Cat No. 11259-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IHC, ELISA

Synonyms

FMN2, formin 2

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

11259-1-AP targets FMN2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1774

  Product name: Recombinant human FMN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1509-1722 aa of BC014364

  Sequence: GQADGFGLDILPKLKDVKSSDNSRSLLSYIVSYYLRNFDEDAGKEQCLFPLPEPQDLFQASQMKFEDFQKDLRKLKKDLKACEVEAGKVYQVSSKEHMQPFKENMEQFIIQAKIDQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT

• Full Name: formin 2
• Calculated Molecular Weight: 195 kDa
• Observed Molecular Weight: 195 kDa
• GenBank Accession Number: BC014364
• Gene Symbol: FMN2
• Gene ID (NCBI): 56776
• RRID: AB_2105250
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; TFAM loss induces nuclear actin assembly upon mDia2 malonylation to promote liver cancer metastasis.; Authors - Qichao Huang
mouse	IF	PLoS Genet; Dissection of a QTL hotspot on mouse distal chromosome 1 that modulates neurobehavioral phenotypes and gene expression.; Authors - Mozhui Khyobeni K
mouse	IF	FASEB J; Decabromodiphenyl ethane exposure damaged the asymmetric division of mouse oocytes by inhibiting the inactivation of cyclin-dependent kinase 1.; Authors - Feifei Shi
human	WB,IHC	J Ovarian Res; Heterozygous FMN2 missense variant found in a family case of premature ovarian insufficiency.; Authors - Jie Li
human	WB	Cell Rep; Substrate rigidity dictates colorectal tumorigenic cell stemness and metastasis via CRAD-dependent mechanotransduction.; Authors - Yuhan Chang
mouse	WB	Autophagy; PLD1 promotes Spindle Assembly and migration through regulating autophagy in mouse oocyte meiosis; Authors - Jiaqi Zhang