Tested Applications
Positive WB detected in | MCF7 cells, A549 cells, MCF-7 cells, SKOV-3 cells |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11069-2-AP targets FMR1NB in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1531 Product name: Recombinant human FMR1NB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 91-186 aa of BC034320 Sequence: CSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQ Predict reactive species |
Full Name | fragile X mental retardation 1 neighbor |
Calculated Molecular Weight | 29 kDa |
Observed Molecular Weight | 66 kDa |
GenBank Accession Number | BC034320 |
Gene Symbol | FMR1NB |
Gene ID (NCBI) | 158521 |
RRID | AB_2105567 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8N0W7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FMR1NB antibody 11069-2-AP | Download protocol |
IHC protocol for FMR1NB antibody 11069-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |