FMR1NB Polyclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 11069-2-AP (same clone as 11069-2-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11069-2-AP (FMR1NB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 11069-2-AP (same clone as 11069-2-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 11069-2-AP (FMR1NB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 11069-2-AP (same clone as 11069-2-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 11069-2-AP (FMR1NB antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 11069-2-AP (same clone as 11069-2-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11069-2-AP (FMR1NB antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 11069-2-AP (same clone as 11069-2-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 11069-2-AP (FMR1NB antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11069-2-AP (same clone as 11069-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11069-2-AP (FMR1NB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11069-2-PBS in a different storage buffer formulation.

FMR1NB Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11069-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11069-2-PBS targets FMR1NB in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1531

  Product name: Recombinant human FMR1NB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-186 aa of BC034320

  Sequence: CSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQ

• Full Name: fragile X mental retardation 1 neighbor
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC034320
• Gene Symbol: FMR1NB
• Gene ID (NCBI): 158521
• RRID: AB_2105567
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0W7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.