Tested Applications
Positive WB detected in | mouse liver tissue, mouse stomach tissue, mouse skeletal muscle tissue, rat liver tissue |
Positive IHC detected in | mouse skeletal muscle tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 28 publications below |
IHC | See 8 publications below |
IF | See 4 publications below |
Product Information
23995-1-AP targets FNDC5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21195 Product name: Recombinant human FNDC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-76 aa of BC062297 Sequence: SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR Predict reactive species |
Full Name | fibronectin type III domain containing 5 |
Calculated Molecular Weight | 212 aa, 24 kDa |
Observed Molecular Weight | 25-30 kDa |
GenBank Accession Number | BC062297 |
Gene Symbol | FNDC5 |
Gene ID (NCBI) | 252995 |
RRID | AB_2879394 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NAU1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
fibronectin type III domain containing 5(FNDC5)encodes 23kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. The exercise induces muscle FNDC5 expression. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FNDC5 antibody 23995-1-AP | Download protocol |
IHC protocol for FNDC5 antibody 23995-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Clin Transl Med CRISPRa-based activation of Fgf21 and Fndc5 ameliorates obesity by promoting adipocytes browning | ||
Neuropathol Appl Neurobiol Irisin treatment lowers levels of phosphorylated tau in the hippocampus of pre-symptomatic female but not male htau mice. | ||
Aging (Albany NY) Vitellogenin 2 promotes muscle development and stimulates the browning of white fat | ||
J Am Heart Assoc Irisin Lowers Blood Pressure by Improvement of Endothelial Dysfunction via AMPK-Akt-eNOS-NO Pathway in the Spontaneously Hypertensive Rat. | ||
Biochim Biophys Acta Mol Basis Dis Irisin is induced in renal ischemia-reperfusion to protect against tubular cell injury via suppressing p53. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mohammad (Verified Customer) (12-02-2019) | 1:600 in mice hippocampusworks well with no non-specific band
|