Tested Applications
| Positive WB detected in | HepG2 cells, C2C12 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, pig skeletal muscle tissue, mouse stomach tissue, rat stomach tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82671-1-RR targets FNDC5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29714 Product name: Recombinant human FNDC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-153 aa of BC062297 Sequence: IIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW Predict reactive species |
| Full Name | fibronectin type III domain containing 5 |
| Calculated Molecular Weight | 212 aa, 24 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC062297 |
| Gene Symbol | FNDC5 |
| Gene ID (NCBI) | 252995 |
| RRID | AB_3086499 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8NAU1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
fibronectin type III domain containing 5(FNDC5) encodes 23 kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FNDC5 antibody 82671-1-RR | Download protocol |
| WB protocol for FNDC5 antibody 82671-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





