Tested Applications
Positive WB detected in | mouse liver tissue, rat liver tissue |
Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
28380-1-AP targets FNIP1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.
Tested Reactivity | Human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28976 Product name: Recombinant human FNIP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 163-250 aa of BC001956 Sequence: FTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNE Predict reactive species |
Full Name | folliculin interacting protein 1 |
Calculated Molecular Weight | 508 aa, 57 kDa |
Observed Molecular Weight | 130-150 kDa |
GenBank Accession Number | BC001956 |
Gene Symbol | FNIP1 |
Gene ID (NCBI) | 96459 |
RRID | AB_2881128 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TF40 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Folliculin-interacting protein 1 (FNIP1) forms a complex with the protein folliculin (FLCN), together acting as guanosine triphosphate (GTP)-activating protein (GAP) for RagC. The FNIP1-FLCN complex has emerged as an amino acid sensor to the mechanistic target of rapamycin complex 1 (mTORC1), involved in how amino acids control TFEB activation. AMPK phosphorylation of FNIP1 induces lysosomal and mitochondrial biogenesis (PMID: 37079666)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FNIP1 antibody 28380-1-AP | Download protocol |
IF protocol for FNIP1 antibody 28380-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |