FOLR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FOLR2 Polyclonal antibody, PBS Only (31264-1-PBS)

• 

  WB analysis using 31264-1-AP (same clone as 31264-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31264-1-AP (FOLR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31264-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31264-1-AP (same clone as 31264-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31264-1-AP (FOLR2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31264-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31264-1-AP (same clone as 31264-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FOLR2 antibody (31264-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31264-1-PBS in a different storage buffer formulation.

FOLR2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31264-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BETA HFR, FBP, FBP/PL 1, Folate receptor 2, folate receptor 2 (fetal)

---

Product Information

31264-1-PBS targets FOLR2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0953

  Product name: recombinant human FOLR2 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 17-228 aa of NM_000803.5

  Sequence: TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

• Full Name: folate receptor 2 (fetal)
• Calculated Molecular Weight: 29KD
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: NM_000803.5
• Gene Symbol: FOLR2
• Gene ID (NCBI): 2350
• RRID: AB_3669922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P14207
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOLR2 (Folate Receptor 2), also known as Folate Receptor beta (FR-beta), is a 38 kDa glycoprotein that is anchored to the cell membrane via glycosyl phosphatidylinositol (GPI) linkage . FOLR2 belongs to the folate receptor (FOLR) family, which also includes FOLR1 (FR-α), FOLR3 (FR-γ), and FOLR4. FOLR2 has been shown to be expressed by malignant cells, including myelogenous leukemia cells, but has also been demonstrated to be mainly expressed by tumor-associated macrophages (TAMs).