• Featured Product
  • KD/KO Validated

c-Fos Monoclonal antibody

c-Fos Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 66590-1-Ig
Clone No.1G2C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, FC (Intra), IP, CoIP, ELISA

FOS, 1G2C5, AP 1, C FOS, Cellular oncogene fos

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HSC-T6 cells, Jurkat cells, U-937 cells, RAW 264.7 cells, K-562 cells, THP-1 cells, NIH/3T3 cells
Positive FC (Intra) detected inHeLa cells

c-Fos is an extremely short-lived intracellular protein that needs to be detected in fresh samples to prevent its degradation.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66590-1-Ig targets c-Fos in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24340

Product name: Recombinant human FOS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 196-341 aa of BC004490

Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF

Predict reactive species
Full Name FOS
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC004490
Gene Symbol c-Fos
Gene ID (NCBI) 2353
RRIDAB_2881950
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01100
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.

Protocols

Product Specific Protocols
FC protocol for c-Fos antibody 66590-1-IgDownload protocol
WB protocol for c-Fos antibody 66590-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
mouse

Curr Biol

Neural processing of the reward value of pleasant odorants.

Authors - Maëllie Midroit
humanWB

Theranostics

KDM6A promotes imatinib resistance through YY1-mediated transcriptional upregulation of TRKA independently of its demethylase activity in chronic myelogenous leukemia.

Authors - Chengwan Zhang
  • KD Validated
mouse

Phytomedicine

Withaferin A protects against epilepsy by promoting LCN2-mediated astrocyte polarization to stopping neuronal ferroptosis

Authors - Zixian Zhou
mouse

Phytomedicine

Gastrodin alleviates NTG-induced migraine-like pain via inhibiting succinate/HIF-1α/TRPM2 signaling pathway in trigeminal ganglion

Authors - Chao Ma
humanIHC

J Transl Med

Integrating spatial transcriptomics and single-cell RNA-sequencing reveals the alterations in epithelial cells during nodular formation in benign prostatic hyperplasia

Authors - Xiawei Fei

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Pratiksha (Verified Customer) (03-28-2026)

The antibody worked on IF for brain slices at 1:750 but did not work for Adipo cleared whole brain.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:750
  • Cell Tissue Type: Brain
FH

Reyes (Verified Customer) (02-14-2025)

cFOS (a nuclear marker) did not perform as expected in my epileptic human FFPE tissue. It seems to appear in the nucleus in a few cells, but also a strong marking in the cyoplasm of others.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
c-Fos Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:66590-1-Ig)
FH

Tatyana (Verified Customer) (01-21-2023)

Suitable for IHC in the paraffinised brain sections of mice (cortex). Samples were fixed in 4% and standard IHC procedure with antigen retrieval and DAB detection was performed. Antibody was incubated at 1:1000 dilution overnight at 4C. Provided a good specific signal in neurons that increased after restraint stress.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse CNS tissue
c-Fos Antibody Immunohistochemistry validation (1:1000 dilution) in Mouse CNS tissue (Cat no:66590-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...