Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, HSC-T6 cells, Jurkat cells, U-937 cells, RAW 264.7 cells, K-562 cells, THP-1 cells, NIH/3T3 cells |
c-Fos is an extremely short-lived intracellular protein that needs to be detected in fresh samples to prevent its degradation.
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 86 publications below |
IHC | See 14 publications below |
IP | See 3 publications below |
CoIP | See 1 publications below |
Product Information
66590-1-Ig targets c-Fos in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, rabbit |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24340 Product name: Recombinant human FOS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 196-341 aa of BC004490 Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF Predict reactive species |
Full Name | FOS |
Calculated Molecular Weight | 41 kDa |
Observed Molecular Weight | 55-60 kDa |
GenBank Accession Number | BC004490 |
Gene Symbol | c-Fos |
Gene ID (NCBI) | 2353 |
RRID | AB_2881950 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P01100 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for c-Fos antibody 66590-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Theranostics KDM6A promotes imatinib resistance through YY1-mediated transcriptional upregulation of TRKA independently of its demethylase activity in chronic myelogenous leukemia.
| ||
Phytomedicine Withaferin A protects against epilepsy by promoting LCN2-mediated astrocyte polarization to stopping neuronal ferroptosis | ||
Phytomedicine Gastrodin alleviates NTG-induced migraine-like pain via inhibiting succinate/HIF-1α/TRPM2 signaling pathway in trigeminal ganglion | ||
J Transl Med Integrating spatial transcriptomics and single-cell RNA-sequencing reveals the alterations in epithelial cells during nodular formation in benign prostatic hyperplasia |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Reyes (Verified Customer) (02-14-2025) | cFOS (a nuclear marker) did not perform as expected in my epileptic human FFPE tissue. It seems to appear in the nucleus in a few cells, but also a strong marking in the cyoplasm of others.
![]() |
FH Tatyana (Verified Customer) (01-21-2023) | Suitable for IHC in the paraffinised brain sections of mice (cortex). Samples were fixed in 4% and standard IHC procedure with antigen retrieval and DAB detection was performed. Antibody was incubated at 1:1000 dilution overnight at 4C. Provided a good specific signal in neurons that increased after restraint stress.
![]() |