• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated c-Fos Monoclonal antibody

c-Fos Monoclonal Antibody for FC (Intra)
Cat No. CL488-66590
Clone No.1G2C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

FOS, Fos proto-oncogene, AP-1 transcription factor subunit, Cellular oncogene fos, C FOS, AP 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66590 targets c-Fos in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24340

Product name: Recombinant human FOS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 196-341 aa of BC004490

Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF

Predict reactive species
Full Name FOS
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC004490
Gene Symbol c-Fos
Gene ID (NCBI) 2353
RRIDAB_2934481
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01100
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

c-FOS, also named as Proto-oncogene c-Fos and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. FOS is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, FOS undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the FOS protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the FOS protein becomes nuclear. The calculated molecular weight of FOS is 40 kDa, but Phosphorylated FOS protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-fos is an indirect marker of neuronal activity because c-fos is often expressed when neurons fire action potentials. Upregulation of c-fos mRNA in a neuron indicates recent activity

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 c-Fos antibody CL488-66590Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lindsay (Verified Customer) (09-04-2025)

This pre-conjugated c-fos primary works very well in mouse brain tissue, and limits the time required for single or dual color IHC staining with secondaries. It may not be as stable as others, though, as we found the conjugate to stop working after fewer freeze-thaw cycles than the non-conjugated fos primaries from PT.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: brain (mouse)a
Loading...
||
New chat Able
正在加载,请稍候...