c-Fos Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 66590-1-Ig (same clone as 66590-1-PBS)

  WB result of c-Fos antibody (66590-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-c-Fos transfected HepG2 cells. This data was developed using the same antibody clone with 66590-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66590-1-Ig (same clone as 66590-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66590-1-Ig (c-Fos antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66590-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66590-1-Ig (same clone as 66590-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66590-1-Ig (c-Fos antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66590-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66590-1-Ig (same clone as 66590-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66590-1-Ig (c-Fos antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66590-1-Ig (same clone as 66590-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66590-1-Ig (FOS antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66590-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

c-Fos Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66590-1-PBS

Clone No.1G2C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

FOS, Fos proto-oncogene, AP-1 transcription factor subunit, Cellular oncogene fos, C FOS, AP 1

---

c-Fos is an extremely short-lived intracellular protein that needs to be detected in fresh samples to prevent its degradation.

Product Information

66590-1-PBS targets c-Fos in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24340

  Product name: Recombinant human FOS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-341 aa of BC004490

  Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF

• Full Name: FOS
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC004490
• Gene Symbol: c-Fos
• Gene ID (NCBI): 2353
• RRID: AB_2881950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P01100
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.