• Featured Product
  • KD/KO Validated

c-Fos Monoclonal antibody, PBS Only

c-Fos Monoclonal Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 66590-1-PBS
Clone No.1G2C5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

FOS, 1G2C5, AP 1, C FOS, Cellular oncogene fos

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


c-Fos is an extremely short-lived intracellular protein that needs to be detected in fresh samples to prevent its degradation.

Product Information

66590-1-PBS targets c-Fos in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24340

Product name: Recombinant human FOS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 196-341 aa of BC004490

Sequence: ILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSF

Predict reactive species
Full Name FOS
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC004490
Gene Symbol c-Fos
Gene ID (NCBI) 2353
RRIDAB_2881950
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP01100
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

c-Fos, also named as FOS and G0/G1 switch regulatory protein 7, is a 380 amino acid protein, which contains 1 bZIP (basic-leucine zipper) domain and belongs to the bZIP family. c-Fos is expressed at very low levels in quiescent cells. When cells are stimulated to reenter growth, c-Fos undergo 2 waves of expression, the first one peaks 7.5 minutes following FBS induction. At this stage, the c-Fos protein is localized endoplasmic reticulum. The second wave of expression occurs at about 20 minutes after induction and peaks at 1 hour. At this stage, the c-FOS protein becomes nuclear. c-Fos is a very short-lived intracellular protein, which is very easy to degrade. The calculated molecular weight of c-Fos is 40 kDa, but Phosphorylated c-Fos protein is about 60-65 kDa. It is involved in important cellular events, including cell proliferation, differentiation and survival; genes associated with hypoxia; and angiogenesis; which makes its dysregulation an important factor for cancer development. It can also induce a loss of cell polarity and epithelial-mesenchymal transition, leading to invasive and metastatic growth in mammary epithelial cells. Expression of c-Fos is an indirect marker of neuronal activity because c-Fos is often expressed when neurons fire action potentials. Upregulation of c-Fos mRNA in a neuron indicates recent activity.

Loading...
||
New chat

Able

正在加载,请稍候...