Recombinant human FOXA2 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag18221
Synonyms
HNF3B; MGC19807; TCF3B
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP
(1-160 aa encoded by BC011780) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
