Tested Applications
Positive WB detected in | NIH/3T3 cells, Jurkat cells, RAW 264.7 cells, U-937 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24835-1-AP targets FOXD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19226 Product name: Recombinant human FOXD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 361-439 aa of BC136570 Sequence: ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS Predict reactive species |
Full Name | forkhead box D4 |
Calculated Molecular Weight | 439 aa, 47 kDa |
Observed Molecular Weight | 65-70 kDa |
GenBank Accession Number | BC136570 |
Gene Symbol | FOXD4 |
Gene ID (NCBI) | 2298 |
RRID | AB_2879750 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q12950 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Forkhead box protein D4(FOXD4)also named as FKHL9 or Myeloid factor alpha is a 439 amino acid protein, which contains one fork head DNA-binding domain. FOXD4L6 localizes in the nucleus. FOXD4 as an embryonic transcriptional regulator involves in leukemogenesis. The molecular weight of FOXD4L6 is 47kDa, but our experiment always detected a 60-70kDa protein by western blot.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FOXD4 antibody 24835-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |