FOXD4 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 24835-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24835-1-AP (FOXD4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 24835-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 24835-1-AP (FOXD4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 24835-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 24835-1-AP (FOXD4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24835-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24835-1-AP (FOXD4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FOXD4 Polyclonal Antibody for WB, ELISA

Cat No. 24835-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FKHL9, forkhead box D4, Forkhead box protein D4, Forkhead related protein FKHL9, FOXD4, FOXD4A, FREAC 5, FREAC5, Myeloid factor alpha

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, Jurkat cells, RAW 264.7 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24835-1-AP targets FOXD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19226

  Product name: Recombinant human FOXD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 361-439 aa of BC136570

  Sequence: ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS

• Full Name: forkhead box D4
• Calculated Molecular Weight: 439 aa, 47 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC136570
• Gene Symbol: FOXD4
• Gene ID (NCBI): 2298
• RRID: AB_2879750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12950
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Forkhead box protein D4(FOXD4)also named as FKHL9 or Myeloid factor alpha is a 439 amino acid protein, which contains one fork head DNA-binding domain. FOXD4L6 localizes in the nucleus. FOXD4 as an embryonic transcriptional regulator involves in leukemogenesis. The molecular weight of FOXD4L6 is 47kDa, but our experiment always detected a 60-70kDa protein by western blot.