FOXR1 Polyclonal antibody

• 

  WB analysis of fetal human brain using 21942-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21942-1-AP (FOXR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21942-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21942-1-AP (FOXR1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 21942-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21942-1-AP (FOXR1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21942-1-AP

  IP result of anti-FOXR1 (IP:21942-1-AP, 4ug; Detection:21942-1-AP 1:500) with mouse brain tissue lysate 4000ug.

FOXR1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 21942-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

FOXR 1, FOXN5, DLNB13

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21942-1-AP targets FOXR1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16625

  Product name: Recombinant human FOXR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 58-181 aa of BC028191

  Sequence: NPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRFAFSPSTWELTEEEEAEDQEDSSSMALPSPHKRAPLQSRRLRQASSQAGRLWSRPPLNYFHL

• Full Name: forkhead box R1
• Calculated Molecular Weight: 292 aa, 33 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC028191
• Gene Symbol: FOXR1
• Gene ID (NCBI): 283150
• RRID: AB_2878952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PIV2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXR1, also known as FOXN5 (forkhead box N5) or DLNB13, is a 292 amino acid protein that contains a fkh DNA-binding domain. The Genome-based tissue expression consortium indicate that FOXR1 is expressed in the human brain and reproductive organs.