Tested Applications
Positive WB detected in | fetal human brain tissue, mouse brain tissue |
Positive IP detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21942-1-AP targets FOXR1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16625 Product name: Recombinant human FOXR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 58-181 aa of BC028191 Sequence: NPNIVYPPGKLEVSGRRKREDLTSTLPSSQPPQKEEDASCSEAAGVESLSQSSSKRSPPRKRFAFSPSTWELTEEEEAEDQEDSSSMALPSPHKRAPLQSRRLRQASSQAGRLWSRPPLNYFHL Predict reactive species |
Full Name | forkhead box R1 |
Calculated Molecular Weight | 292 aa, 33 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC028191 |
Gene Symbol | FOXR1 |
Gene ID (NCBI) | 283150 |
RRID | AB_2878952 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6PIV2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXR1, also known as FOXN5 (forkhead box N5) or DLNB13, is a 292 amino acid protein that contains a fkh DNA-binding domain. The Genome-based tissue expression consortium indicate that FOXR1 is expressed in the human brain and reproductive organs.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FOXR1 antibody 21942-1-AP | Download protocol |
IP protocol for FOXR1 antibody 21942-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |