FSD1L Polyclonal antibody

• 

  IHC staining of human brain using 21032-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21032-1-AP (FSD1L antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 21032-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21032-1-AP (FSD1L antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 21032-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HepG2 using 21032-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HEK-293 using 21032-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using FSD1L antibody (21032-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

FSD1L Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 21032-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

FSD1-like protein, FSD1CL, FSD1 N-terminal-like protein, CSDUFD1, Coiled-coil domain-containing protein 10

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HEK-293 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21032-1-AP targets FSD1L in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15345

  Product name: Recombinant human FSD1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 418-530 aa of BC036746

  Sequence: TSWCIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKFTQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ

• Full Name: fibronectin type III and SPRY domain containing 1-like
• Calculated Molecular Weight: 530 aa, 60 kDa
• Observed Molecular Weight: 56-65 kDa
• GenBank Accession Number: BC036746
• Gene Symbol: FSD1L
• Gene ID (NCBI): 83856
• RRID: AB_10732808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXM9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.