FTO Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81471-1-RR (same clone as 81471-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81471-1-RR (FTO antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81471-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-231 using 81471-1-RR (same clone as 81471-1-PBS)

  WB result of FTO antibody (81471-1-RR; 1:600; room temperature for 1.5 hours) with wild-type and FTO knockout MDA-MB-231 cells. This data was developed using the same antibody clone with 81471-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 81471-1-RR (same clone as 81471-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FTO antibody (81471-1-RR, Clone: 4L4 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 81471-1-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 81471-1-RR (same clone as 81471-1-PBS)

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.25 ug FTO Recombinant antibody (81471-1-RR, Clone:4L4) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 81471-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FTO Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81471-1-PBS

Clone No.4L4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

4L4, KIAA1752

---

Product Information

81471-1-PBS targets FTO in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26095

  Product name: Recombinant human FTO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 400-505 aa of NM_001080432

  Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP

• Full Name: fat mass and obesity associated
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: NM_001080432
• Gene Symbol: FTO
• Gene ID (NCBI): 79068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9C0B1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in th1e FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.