FUNDC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FUNDC1 Polyclonal antibody (28519-1-AP)

• 

  WB analysis using 28519-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28519-1-AP (FUNDC1 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28519-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28519-1-AP (FUNDC1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28519-1-AP

  A-673 cells were subjected to SDS PAGE followed by western blot with 28519-1-AP (FUNDC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 28519-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 28519-1-AP (FUNDC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 28519-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 28519-1-AP (FUNDC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

FUNDC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28519-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, CoIP, ELISA

Synonyms

FUN14 domain containing 1, FUN14 domain-containing protein 1, FUNDC 1

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, A-673 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue, C6 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 17 publications below
• IHC: See 1 publications below
• CoIP: See 1 publications below

Product Information

28519-1-AP targets FUNDC1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey, chicken, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29358

  Product name: Recombinant human FUNDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-155 aa of BC042813

  Sequence: QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS

• Full Name: FUN14 domain containing 1
• Calculated Molecular Weight: 155 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC042813
• Gene Symbol: FUNDC1
• Gene ID (NCBI): 139341
• RRID: AB_2935469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVP5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUNDC1 is a novel mitochondrial-associated membrane (MAM) protein, enriched at the MAM by interacting with the ER resident protein CANX (calnexin) under hypoxia. As mitophagy proceeds, it dissociates from CANX and preferably recruits DNM1L/DRP1 to drive mitochondrial fission in response to hypoxic stress.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Clin Sci (Lond); Loss of FoxO1 activates an alternate mechanism of mitochondrial quality control for healthy adipose browning; Authors - Limin Shi ; KD Validated
mouse	WB	Autophagy Rep; A liver-fat crosstalk for iron flux during healthy beiging of adipose tissue; Authors - Jinying Yang
	WB	Biochim Biophys Acta Mol Basis Dis; Platycodin D attenuates diabetic renal ischemia/reperfusion injury by enhancing mitophagy and suppressing MAPK/NF-κB signaling activation; Authors - Xuke Qin
rat	WB	Mol Med; PI3K p85α/HIF-1α accelerates the development of pulmonary arterial hypertension by regulating fatty acid uptake and mitophagy; Authors - Chenyang Chen
monkey	WB	PLoS Pathog; Calcium-mediated mitochondrial fission and mitophagy drive glycolysis to facilitate arterivirus proliferation; Authors - Zhe Sun
rat,mouse	WB	Cell Death Dis; O-GlcNAcylation of YAP1 promotes lung transplant ischemia-reperfusion injury via binding to HIF1α transcription factor and activating autophagy and mitophagy.; Authors - Shaohua Dai