Tested Applications
| Positive WB detected in | RAW 264.7 cells, A-673 cells, mouse brain tissue, mouse liver tissue, rat brain tissue, rat liver tissue, C6 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 11 publications below |
| IHC | See 1 publications below |
Product Information
28519-1-AP targets FUNDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29358 Product name: Recombinant human FUNDC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-155 aa of BC042813 Sequence: QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS Predict reactive species |
| Full Name | FUN14 domain containing 1 |
| Calculated Molecular Weight | 155 aa, 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC042813 |
| Gene Symbol | FUNDC1 |
| Gene ID (NCBI) | 139341 |
| RRID | AB_2935469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IVP5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FUNDC1 is a novel mitochondrial-associated membrane (MAM) protein, enriched at the MAM by interacting with the ER resident protein CANX (calnexin) under hypoxia. As mitophagy proceeds, it dissociates from CANX and preferably recruits DNM1L/DRP1 to drive mitochondrial fission in response to hypoxic stress.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for FUNDC1 antibody 28519-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Sci (Lond) Loss of FoxO1 activates an alternate mechanism of mitochondrial quality control for healthy adipose browning
| ||
PLoS Pathog Calcium-mediated mitochondrial fission and mitophagy drive glycolysis to facilitate arterivirus proliferation | ||
J Exp Clin Cancer Res Synthetic lethality of combined ULK1 defection and p53 restoration induce pyroptosis by directly upregulating GSDME transcription and cleavage activation through ROS/NLRP3 signaling | ||
Mol Med PI3K p85α/HIF-1α accelerates the development of pulmonary arterial hypertension by regulating fatty acid uptake and mitophagy | ||
Redox Biol Targeting Dio3 to enhance mitophagy and ameliorate skeletal muscle wasting in sepsis | ||
Autophagy Rep A liver-fat crosstalk for iron flux during healthy beiging of adipose tissue |





