Product Information
83860-1-PBS targets FXYD2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34030 Product name: Recombinant human FXYD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP* Predict reactive species |
| Full Name | FXYD domain containing ion transport regulator 2 |
| Calculated Molecular Weight | 7 kDa |
| Observed Molecular Weight | 7-10 kDa |
| GenBank Accession Number | BC013289 |
| Gene Symbol | FXYD2 |
| Gene ID (NCBI) | 486 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P54710 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2.





