FXYD2 Recombinant monoclonal antibody

FXYD2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83860-1-RR
Clone No.240649C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

240649C2, ATP1C, ATP1G1, FXYD 2, FXYD domain-containing ion transport regulator 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman kidney tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83860-1-RR targets FXYD2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34030

Product name: Recombinant human FXYD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-66 aa of BC013289

Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP*

Predict reactive species
Full Name FXYD domain containing ion transport regulator 2
Calculated Molecular Weight 7 kDa
Observed Molecular Weight 7-10 kDa
GenBank Accession NumberBC013289
Gene Symbol FXYD2
Gene ID (NCBI) 486
RRIDAB_3671444
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP54710
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2.

Protocols

Product Specific Protocols
FC protocol for FXYD2 antibody 83860-1-RRDownload protocol
WB protocol for FXYD2 antibody 83860-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...